General Information

  • ID:  hor007023
  • Uniprot ID:  P35230
  • Protein name:  Regenerating islet-derived protein 3-beta 16.5 kDa form
  • Gene name:  gh
  • Organism:  Mus musculus
  • Family:  NA
  • Source:  Animal
  • Expression:  Constitutively expressed in the small intestine; moderately in colon and at an extremely low level in healthy pancreas.
  • Disease:  NA
  • Comments:  NA
  • Taxonomy:  Eukaryota; Opisthokonta; Metazoa; Eumetazoa; Bilateria; Deuterostomia; Chordata; Craniata; Vertebrata; Gnathostomata (jawed vertebrates); Teleostomi; Euteleostomi; Sarcopterygii; Dipnotetrapodomorpha; Tetrapoda; Amniota; Mammalia; Theria; Eutheria; Boreoeutheria; Euarchontoglires; Glires (Rodents and rabbits); Rodentia; Myomorpha (mice and others); Muroidea; Muridae; Murinae; Mus; Mus; Mus musculus (Mouse)
  • GO MF:  GO:0045177 apical part of cell; GO:0062023 collagen-containing extracellular matrix; GO:0005615 extracellular space; GO:0032991 protein-containing complex; GO:0042588 zymogen granule
  • GO BP:  GO:0042834 peptidoglycan binding; GO:0070492 oligosaccharide binding; GO:0046872 metal ion binding; GO:0042802 identical protein binding; GO:0019838 growth factor binding; GO:0038023 signaling receptor activity
  • GO CC:  GO:0006953 acute-phase response; GO:0061844 antimicrobial humoral immune response mediated by antimicrobial peptide; GO:0050829 defense response to Gram-negative bacterium; GO:0050830 defense response to Gram-positive bacterium; GO:1900408 negative regulation of cellular response to oxidative stress; GO:0008284 positive regulation of cell population proliferation; GO:0001934 positive regulation of protein phosphorylation; GO:0009617 response to bacterium; GO:0043434 response to peptide hormone

Sequence Information

  • Sequence:  DSLKNIPSARISCPKGSQAYGSYCYALFQIPQTWFDAELACQKRPGGHLVSVLNSAEASFLSSMVKRTGNSYQYTWIGLHDPTLGAEPNGGGWEWSNNDVMNYFNWERNPSTALDRAFCGSLSRASGFLKWRDMTCEVKLPYVCKFTG
  • Length:  148
  • Propeptide:  MLPPTACSVMSWMLLSCLMLLSQVQGEDSLKNIPSARISCPKGSQAYGSYCYALFQIPQTWFDAELACQKRPGGHLVSVLNSAEASFLSSMVKRTGNSYQYTWIGLHDPTLGAEPNGGGWEWSNNDVMNYFNWERNPSTALDRAFCGSLSRASGFLKWRDMTCEVKLPYVCKFTG
  • Signal peptide:  MLPPTACSVMSWMLLSCLMLLSQVQG
  • Modification:  T2 N-acetylalanine
  • Glycosylation:  NA
  • Mutagenesis:  NA

Activity

  • Function:  NA
  • Mechanism:  NA
  • Cross BBB:  NA
  • Target:  NA
  • Target Unid:  NA
  • IC50: NA
  • EC50: NA
  • ED50: NA
  • kd: NA
  • Half life: NA

Structure

  • Disulfide bond:  NA
  • Structure ID:  NA
  • Structure: (PDB_ID-from https://www.rcsb.org/; AlphaFold_DB_ID-from https://alphafold.ebi.ac.uk/; hordbxxxxxx_AF2.pdb was predicted structure by AlphaFold2; hordbxxxxxx_ESM.pdb was predicted structure by ESMFold)
  •    NA

Physical Information

Mass: Formula:
Absent amino acids: Common amino acids:
pI: Basic residues:
Polar residues: Hydrophobic residues:
Hydrophobicity: Boman Index:
Half-Life: Half-Life Yeast:
Half-Life E.Coli: Aliphatic Index
Instability Index: Extinction Coefficient cystines:
Absorbance 280nm:

Literature

  • PubMed ID:  NA
  • Title:  NA